A Carpet Cleaning Company In Nassau, Suffolk, Queens, Levittown and Plainview. Our Carpet Cleaners Are Ready To Get Your Carpet Clean The First Time Every Time
Carpet Cleaning Residential and Commercial
Rug Cleaning - Water Extraction
For A Very Limited Time I am Offering A Free Room Of Carpet Cleaning. Have us clean your whole house of carpet and I'll give you one room of carpet cleaning Free. Remember clean carpet is great for your health. It enhances the beauty of the inside of your home and makes one feel great about living on fresh clean smelling carpet. Â "Some restriction apply..."
My no hassle, quick carpet cleaning means your carpets will be looking great, clean, fresh, and dry in much less than 4 hours. I use professional trained carpet cleaner tradesmen. My objective is to always get your carpets clean. Cleaned carpets look fantastic, smells fresh, and feels like new once more. The truck-mounted carpet cleaning equipment recovers 90% of all water utilized to clean. I Guarantee the Cleanest Carpet feasible. First Time, Every Time! The certified trained technicians clean your carpet with the most powerful cleaning systems obtainable and the best and safest solutions utilized by any steam cleaning company.
I Use Green Products That Are Children and Pet Safe.
Earth Friendly, Green Carpet Cleaning, Organic Carpet Cleaning Products, Zero Residue Cleaning, Quick Drying, Hypo-Allergenic Cleaning Products.
Green Carpet Cleaning Plus All This...
|
|
![]()
Carpet Cleaning
My carpet cleaning company use the most advanced truck-mounted cleaning system, which will eliminate ground-in dirt and restore your carpet's look. Other services such as deodorizer, carpet repair, and our stain-resistant protective coating are obtainable.
| Here Is What My Customers Are Saying... |
Jimmy W - Levittown, NY Excellent. Presented their company in a extremely professional manner. All efforts taken to offer meticulous service.
|
My Cleaning Proced:
- Pre-examine areas for carpet problems
- Pre-treatment of spots at the technician's discretion.
- Clean carpet with the truck-mounted system. This method will inject hot water with a mild cleaning agent (created to enhance the suspension of soil) then instantly extract it out utilizing the powerful vacuum of the machine. (Our trucks have a holding tank for dirty water. We do not recycle the water).
- I or my staff move most furniture that one man can move. We DO NOT move antiques, electronics or breakables. We will move furniture a few feet, clean the carpet, and return the furniture to the original spot. Furniture is placed on blocks or pads to stop furniture stains on the carpet.
- Depending on the kind of carpet, the final step is raking. This lifts the pile and helps the carpet dry quicker.
- I do recommend and provide several types of carpet protection.
- If you are not comple satisfied with your carpet cleaning, call within 3 to 5 days of cleaning and we will come back and right the problem.
- I suggest having your carpet cleaned at least once a year. If you have kids and/or pets, we suggest carpet cleaning each and every 3 to 6 months depending on the amount of visitors on the carpet.
With my >>carpet cleaning discount coupons<< , senior coupon discounts you'll not discover a better price. Discover fantastic  residential and commercial carpet cleaning ideas and how to guides, plus info on Area Rugs, Tile and Grout, Hardwood Floors, and much more here on this website/blog.
OUR NEW YORK CARPET CLEANING SERVICE AREA INCLUDES:
LEVITTOWNBETHPAGEEAST MEADOWHICKSVILLEWANTAGHSEAFORDBELLMOREUNIONDALEWESTBURYFARMINGDALEOLD BETHPAGEMASSAPEQUAUNIONDALEMERRICKHEMPSTEADPLAINVIEWJERICHOMASSAPEQUA PARKROOSEVELTJERICHONASSAUSUFFOLKQUEENS
55 Hawk Lane Levittown, NY, 11756 USA
sales@tricountycarpetcleaning.com • 516-665-4026










